Name :
CD28 (Human) Recombinant Protein

Biological Activity :
Purified CD28 (NP_006130.1, 18 a.a. – 152 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro

Tag :

Protein Accession No. :
NP_006130.1

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=940

Amino Acid Sequence :
GNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

Molecular Weight :
20.13

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Human

Interspecies Antigen Sequence :
Mouse (70)

Preparation Method :
Transfection of pSuper-CD28 plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.

Purification :
Strep-Tactin affinity columns

Quality Control Testing :

Storage Buffer :
100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.

Applications :
Western Blot, Enzyme-linked Immunoabsorbent Assay, SDS-PAGE, Protein Interaction,

Gene Name :
CD28

Gene Alias :
MGC138290, Tp44

Gene Description :
CD28 molecule

Gene Summary :
CD28 costimulation is essential for CD4 (MIM 186940)-positive T-cell proliferation, survival, interleukin-2 (IL2; MIM 147680) production, and T-helper type-2 (Th2) development.[supplied by OMIM

Other Designations :
CD28 antigen|CD28 antigen (Tp44)|T-cell-specific surface glycoprotein

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
BRCA1 Antibody custom synthesis CRHR2 Antibody Technical Information PMID:35175195 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com