Name :
TNFSF13 (Human) Recombinant Protein

Biological Activity :
Human TNFSF13 (O75888, 105 a.a. – 247 a.a.) partial-length recombinant protein with T7-tag at N-terminal expressed in Escherichia coli.

Tag :

Protein Accession No. :
O75888

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=8741

Amino Acid Sequence :
MASMTGGQQMGRGSHMAVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGL.

Molecular Weight :
17.6

Storage and Stability :
Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :

Quality Control Testing :

Storage Buffer :
20mM Tris-HCl buffer (pH 8.0), 0.4M UREA and 10% glycerol.

Applications :
SDS-PAGE,

Gene Name :
TNFSF13

Gene Alias :
APRIL, CD256, TALL2, TRDL-1, UNQ383/PRO715, ligand

Gene Description :
tumor necrosis factor (ligand) superfamily, member 13

Gene Summary :
The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. Other transcripts that skip the last exon of the upstream gene (TNFSF12) and continue with the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13. [provided by RefSeq

Other Designations :
OTTHUMP00000174780|TNF- and APOL-related leukocyte expressed ligand 2|a proliferation inducing ligand|tumor necrosis factor (ligand) superfamily member 13 transcript variant delta|tumor necrosis factor ligand superfamily member 13 epsilon|tumor necrosis f

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cathepsin D Recombinant Proteins
TIM-3 medchemexpress
Popular categories:
CD158z/KIR3DL3
CXCR3