Name :
FAS (Human) Recombinant Protein
Biological Activity :
Purified FAS (AAH12479.1, 25 a.a. – 169 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro
Tag :
Protein Accession No. :
AAH12479.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=355
Amino Acid Sequence :
AQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEG
Molecular Weight :
21.23
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Human
Interspecies Antigen Sequence :
Preparation Method :
Transfection of pSuper-FAS plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
Purification :
Strep-Tactin affinity columns
Quality Control Testing :
SDS-PAGE and Western Blot SDS-PAGE Gel Western Blot
Storage Buffer :
100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Applications :
Western Blot， Enzyme-linked Immunoabsorbent Assay， SDS-PAGE， Protein Interaction，
Gene Name :
FAS
Gene Alias :
ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6
Gene Description :
Fas (TNF receptor superfamily, member 6)
Gene Summary :
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. At least eight alternatively spliced transcript variants have been described, some of which are candidates for nonsense-mediated decay (NMD). The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform. [provided by RefSeq
Other Designations :
APO-1 cell surface antigen|CD95 antigen|Fas AMA|Fas antigen|OTTHUMP00000020045|OTTHUMP00000020046|OTTHUMP00000020051|OTTHUMP00000059646|apoptosis antigen 1|tumor necrosis factor receptor superfamily member 6|tumor necrosis factor receptor superfamily, mem
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-1 Recombinant Proteins
FSH Recombinant Proteins
Popular categories:
IL-11
Ubiquitin-Specific Protease 13