IL-22BP Protein
Name :
IL-22BP Protein
Description :
Interleukin-22 receptor subunit alpha-2 (IL-22RA2), also known as interleukin-22-binding protein (IL-22BP), is a subunit of the receptor for interleukin 22. IL-22BP belongs to the type II cytokine receptor family and contains 3 fibronectin type-III domains. IL-22BP/IL-22RA2 is expressed in a range of tissues, including those in the digestive, female reproductive, and immune systems. It is expressed in the placenta, spleen, breast, skin, and lung. It is also detected in the intestinal tract, testis, brain, heart, and thymus. The dominant cell types expressing IL-22BP/IL-22RA2 were mononuclear cells and epithelium. IL-22BP/IL-22RA2 may play an important role as an IL-22 antagonist in the regulation of inflammatory responses. Interleukin-22 (IL-22) is a member of the IL-10 family. It is produced by T cells and induces the production of acute-phase reactants. IL-22 plays important role in the immune response through activation of the STAT 3 signal transduction pathway. Two types of IL-22-binding receptors have been discovered, a membrane-bound receptor and a soluble receptor.
Species :
Human
Uniprotkb :
HEK293
Tag :
hFc
Synonyms :
IL-22BP, CRF2X, ZCYTOR16, IL-22R-α-2, interleukin 22 receptor, α2, CRF2-S1, IL-22RA2, interleukin 22 receptor, alpha 2, CRF2-10, IL-22R-alpha-2
Construction :
A DNA sequence encoding the human IL22RA2 (NP_443194.1) (Met1-Pro263) was expressed with the Fc region of human IgG1 at the C-terminus.
Protein Purity :
> 90 % as determined by SDS-PAGE.
Molecular Weight :
Approxiamtely 55 kDa
Endotoxin :
Formulatione :
Lyophilized from sterile PBS, pH 7.4. Please contact us for any concerns or special requirements. Normally 5 % – 8 % trehalose, mannitol and 0. 01% Tween 80 are added as protectants before lyophilization. Please refer to the specific buffer information in the hard copy of CoA.
Reconstitution :
A hardcopy of datasheet with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage :
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Shipping :
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature.Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.
Research Background :
Interleukin-22 receptor subunit alpha-2 (IL-22RA2), also known as interleukin-22-binding protein (IL-22BP), is a subunit of the receptor for interleukin 22. IL-22BP belongs to the type II cytokine receptor family and contains 3 fibronectin type-III domains. IL-22BP/IL-22RA2 is expressed in a range of tissues, including those in the digestive, female reproductive, and immune systems. It is expressed in the placenta, spleen, breast, skin, and lung. It is also detected in the intestinal tract, testis, brain, heart, and thymus. The dominant cell types expressing IL-22BP/IL-22RA2 were mononuclear cells and epithelium. IL-22BP/IL-22RA2 may play an important role as an IL-22 antagonist in the regulation of inflammatory responses. Interleukin-22 (IL-22) is a member of the IL-10 family. It is produced by T cells and induces the production of acute-phase reactants. IL-22 plays important role in the immune response through activation of the STAT 3 signal transduction pathway. Two types of IL-22-binding receptors have been discovered, a membrane-bound receptor and a soluble receptor.
References and Literature :
1. Whittington HA,et al.(2004) Interleukin-22: a potential immunomodulatory molecule in the lung. Am J Respir Cell Mol Biol. 31(2): 220-6. 2. Dumoutier L,et al.(2001) Cloning and characterization of IL-22 binding protein, a natural antagonist of IL-10-related T cell-derived inducible factor/IL-22. J Immunol. 166(12): 7090-5. 3. Wei CC,et al.(2003) Cloning and characterization of mouse IL-22 binding protein. Genes Immun. 4(3): 204-11.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
SUZ12 Antibody custom synthesis Dutasteride manufacturer PMID:35166849 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
PDIA3 (Human) Recombinant Protein (Q01)
Name :
PDIA3 (Human) Recombinant Protein (Q01)
Biological Activity :
Human PDIA3 partial ORF ( AAH14433, 396 a.a. – 505 a.a.) recombinant protein with GST-tag at N-terminal.
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
AAH14433
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=2923
Amino Acid Sequence :
DVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL
Molecular Weight :
37.84
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Mouse (96)
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，
Gene Name :
PDIA3
Gene Alias :
ER60, ERp57, ERp60, ERp61, GRP57, GRP58, HsT17083, P58, PI-PLC
Gene Description :
protein disulfide isomerase family A, member 3
Gene Summary :
This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates. [provided by RefSeq
Other Designations :
58 kDa microsomal protein|OTTHUMP00000041709|endoplasmic reticulum P58|glucose regulated protein, 58kDa|phospholipase C-alpha|protein disulfide isomerase-associated 3|protein disulfide-isomerase A3
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Alkaline Phosphatase Recombinant Proteins
Dkk-1 ProteinMolecular Weight
Popular categories:
Ubiquitin-Specific Protease 13
Siglec-15
IL-17F Protein
Name :
IL-17F Protein
Description :
The Interleukin 17 (IL-17) family proteins, comprising six members (IL-17A through IL-17F), are secreted, structurally related proteins that share a conserved cystine-knot fold near the C-terminus, but have considerable sequence divergence at the N‑terminus.IL-17F is ligand for IL17RA and IL17RC. The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC. Involved in stimulating the production of other cytokines such as IL6, IL8 and CSF2, and in regulation of cartilage matrix turnover.
Species :
Human
Uniprotkb :
HEK293
Tag :
C-His-Avi
Synonyms :
CANDF6, IL-24, IL24, IL17F, Cytokine ML-1, IL-17F, ML1
Construction :
Recombinant Biotinylated Human IL-17F Protein is expressed from HEK293 with His tag and Avi tag at the C-Terminus. It contains Arg31-Gln163.[Accession |Q96PD4]
Protein Purity :
> 95% as determined by Tris-Bis PAGE; > 95% as determined by HPLC
Molecular Weight :
The protein has a predicted MW of 17.5 /14.9 kDa. Due to glycosylation, the protein migrates to 23-28 kDa based on Tris-Bis PAGE result.
Endotoxin :
Less than 1EU per μg by the LAL method.
Formulatione :
Lyophilized from 0.22μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Reconstitution :
Centrifuge the tube before opening. Reconstituting to a concentration more than 100 μg/ml is recommended. Dissolve the lyophilized protein in distilled water.
Stability & Storage :
-20 to -80°C for 12 months as supplied from date of receipt. -20 to -80°C for 3-6 months in unopened state after reconstitution. 2-8°C for 2-7 days after reconstitution. Recommend to aliquot the protein into smaller quantities for optimal storage. Please minimize freeze-thaw cycles.
Shipping :
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature.Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.
Research Background :
The Interleukin 17 (IL-17) family proteins, comprising six members (IL-17A through IL-17F), are secreted, structurally related proteins that share a conserved cystine-knot fold near the C-terminus, but have considerable sequence divergence at the N‑terminus.IL-17F is ligand for IL17RA and IL17RC. The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC. Involved in stimulating the production of other cytokines such as IL6, IL8 and CSF2, and in regulation of cartilage matrix turnover.
References and Literature :
1. Yang XO, et al. Regulation of inflammatory responses by IL-17F[J]. Journal of Experimental Medicine, 2008, 205(5):1063-1075.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
NR6A1 Antibody Biological Activity SLUG Antibody Data Sheet PMID:35108606 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
GNAS (Human) Recombinant Protein (P01)
Name :
GNAS (Human) Recombinant Protein (P01)
Biological Activity :
Human GNAS full-length ORF ( NP_000507.1, 1 a.a. – 394 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
NP_000507.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=2778
Amino Acid Sequence :
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
Molecular Weight :
72.1
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，
Gene Name :
GNAS
Gene Alias :
AHO, C20orf45, GNAS1, GPSA, GSA, GSP, MGC33735, NESP, PHP1A, PHP1B, POH, dJ309F20.1.1, dJ806M20.3.3
Gene Description :
GNAS complex locus
Gene Summary :
This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5′ exons. Some transcripts contains a differentially methylated region (DMR) at their 5′ exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript is produced from an overlapping locus on the opposite strand. One of the transcripts produced from this locus, and the antisense transcript, are paternally expressed noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein – Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants encoding different isoforms have been found for this gene. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors. [provided by RefSeq
Other Designations :
OTTHUMP00000031740|OTTHUMP00000031756|OTTHUMP00000196026|OTTHUMP00000196030|adenylate cyclase-stimulating G alpha protein|guanine nucleotide binding protein (G protein), alpha stimulating activity polypeptide 1|guanine nucleotide regulatory protein|neuroe
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IGFBP-4 Proteincustom synthesis
IL-12 Proteinmedchemexpress
Popular categories:
EphB6
GFR-alpha-3
IL-17RE Protein
Name :
IL-17RE Protein
Description :
Interleukin 17 Receptor E (IL 17 RE) is an approximately 70 kDa (predicted) transmembrane protein in the family of IL 17 receptors. IL 17 RE is expressed on keratinocytes, mucosal epithelial cells, Th17 cells, and gamma /δ T cells. It associates with the widely expressed IL 17 RA to form a heterodimeric receptor for IL-17C. IL-17C binds to IL 17 RE with high affinity and to IL 17 RA with low affinity. IL 17C expression is induced by inflammatory stimulation in colon and airway epithelial cells, keratinocytes, CD4+ T cells, macrophages, and dendritic cells. It is up regulated in various chronic inflammatory diseases including psoriasis, cystic fibrosis, and chronic obstructive pulmonary disease (COPD). IL 17 RE is reciprocally down regulated in psoriatic lesions. The interaction of IL 17C with IL 17 RE promotes mucosal immunity through the induction of anti bacterial peptides and pro inflammatory cytokines and chemokines. IL 17C action supports the integrity of the colon epithelium following infection induced damage but also contributes to psoriatic skin thickening and the progression of arthritis. IL 17C is additionally up regulated in Th17 cell dependent autoimmunity. In this setting, it exacerbates disease severity by inducing Th17 cell production of IL 17A, IL 17F, IL 22, CCR6, and CCL20. The up regulation of IL 17 RE in hepatocellular carcinoma is associated with poor prognosis.
Species :
Human
Uniprotkb :
Human Cells
Tag :
C-Fc
Synonyms :
IL-17RE, interleukin 17 receptor E, IL17RE, IL-17 RE, IL-17 receptor E
Construction :
Recombinant Human Interleukin-17 Receptor E is produced by our Mammalian expression system and the target gene encoding Thr155-His454 is expressed with a human IgG1 Fc tag at the C-terminus.
Protein Purity :
Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Molecular Weight :
60-75 KDa, reducing conditions
Endotoxin :
Less than 0.1 ng/µg (1 EU/µg) as determined by LAL test.
Formulatione :
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Reconstitution :
Always centrifuge tubes before opening.Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100μg/ml.Dissolve the lyophilized protein in distilled water.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Stability & Storage :
Lyophilized protein should be stored at ≤ -20°C, stable for one year after receipt.Reconstituted protein solution can be stored at 2-8°C for 2-7 days.Aliquots of reconstituted samples are stable at ≤ -20°C for 3 months.
Shipping :
The product is shipped at ambient temperature.Upon receipt, store it immediately at the temperature listed below.
Research Background :
Interleukin 17 Receptor E (IL 17 RE) is an approximately 70 kDa (predicted) transmembrane protein in the family of IL 17 receptors. IL 17 RE is expressed on keratinocytes, mucosal epithelial cells, Th17 cells, and gamma /δ T cells. It associates with the widely expressed IL 17 RA to form a heterodimeric receptor for IL-17C. IL-17C binds to IL 17 RE with high affinity and to IL 17 RA with low affinity. IL 17C expression is induced by inflammatory stimulation in colon and airway epithelial cells, keratinocytes, CD4+ T cells, macrophages, and dendritic cells. It is up regulated in various chronic inflammatory diseases including psoriasis, cystic fibrosis, and chronic obstructive pulmonary disease (COPD). IL 17 RE is reciprocally down regulated in psoriatic lesions. The interaction of IL 17C with IL 17 RE promotes mucosal immunity through the induction of anti bacterial peptides and pro inflammatory cytokines and chemokines. IL 17C action supports the integrity of the colon epithelium following infection induced damage but also contributes to psoriatic skin thickening and the progression of arthritis. IL 17C is additionally up regulated in Th17 cell dependent autoimmunity. In this setting, it exacerbates disease severity by inducing Th17 cell production of IL 17A, IL 17F, IL 22, CCR6, and CCL20. The up regulation of IL 17 RE in hepatocellular carcinoma is associated with poor prognosis.
References and Literature :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Tebuconazole custom synthesis Iohexol Formula PMID:35095763 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com